
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q5M8F7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNSLEQAEDLKAFERRLTEYVSCLQPATGRWRMILIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Protein Names:Recommended name: Nuclear envelope phosphatase-regulatory subunit 1 Alternative name(s): Transmembrane protein 188
Gene Names:Name:cnep1r1 Synonyms:tmem188 ORF Names:TEgg132c10.1
Expression Region:1-125
Sequence Info:full length protein