Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:Q9UR17
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTQPLLQTTPGKRIALPVRVEPKVFFANERTFLSWLSFAVVLGGLSVGLLNFGDRIGKI SAGLFTIVAIGTMGYALGIYHWRASAIRRRGSGPYDDRLGPTILCFVLLAAIITNFVLRM LF
Protein Names:Recommended name: Vacuolar transporter chaperone 1 Alternative name(s): Negative regulator of cdc42
Gene Names:Name:nrf1 Synonyms:vtc1 ORF Names:SPBC21B10.04c
Expression Region:1-122
Sequence Info:full length protein