Recombinant Schizosaccharomyces pombe  Probable V-type proton ATPase 20 kDa proteolipid subunit(vma16)

Recombinant Schizosaccharomyces pombe Probable V-type proton ATPase 20 kDa proteolipid subunit(vma16)

CSB-CF515628SXV
Regular price
$1,153.00 USD
Sale price
$1,153.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:O14046

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLFSTSLWTTTVMSIIVGLYMLFHNSGESFDFGSFLLDTSPYTWGLLGIASCVAFGIIG AAWGIFICGTSILGGAVKAPRIKTKNLISIIFCEVVAIYSLIIAIVFSAKINDINPAGFY TKSHYYTGFALFWGGITVGLCNLICGVCVGITGSSAALADAQDASLFVKVLVVEIFGSVL GLFGLIVGLLIGGKASDFS

Protein Names:Recommended name: Probable V-type proton ATPase 20 kDa proteolipid subunit Short name= V-ATPase 20 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 20 kDa proteolipid subunit

Gene Names:Name:vma16 ORF Names:SPAC2C4.13

Expression Region:1-199

Sequence Info:full length protein

Your list is ready to share