Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rotavirus B (isolate Human/China/ADRV/1982) (RV-B) (Rotavirus B (isolate adult diarrhea rotavirus))
Uniprot NO.:Q86198
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGNRQSSAQLNSHLTHINSQNSNLFISDSKTAVFHTQHILLAAGVGIIATLLVLLLCSCV LNCYLCRRLKRTNGVSSLLERNLRQNGSSAKIYVKPVMQSSTIIEEA
Protein Names:Recommended name: Non-structural protein 1, peptide 1 Short name= NSP1 peptide 1 Alternative name(s): NSP1-1
Gene Names:
Expression Region:1-107
Sequence Info:full length protein