Recombinant Rotavirus B  Non-structural protein 1, peptide 1

Recombinant Rotavirus B Non-structural protein 1, peptide 1

CSB-CF772916RHE
Regular price
$1,089.00 USD
Sale price
$1,089.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rotavirus B (isolate Human/China/ADRV/1982) (RV-B) (Rotavirus B (isolate adult diarrhea rotavirus))

Uniprot NO.:Q86198

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGNRQSSAQLNSHLTHINSQNSNLFISDSKTAVFHTQHILLAAGVGIIATLLVLLLCSCV LNCYLCRRLKRTNGVSSLLERNLRQNGSSAKIYVKPVMQSSTIIEEA

Protein Names:Recommended name: Non-structural protein 1, peptide 1 Short name= NSP1 peptide 1 Alternative name(s): NSP1-1

Gene Names:

Expression Region:1-107

Sequence Info:full length protein