Recombinant Rat Calcium-dependent phospholipase A2(Pla2g5)

Recombinant Rat Calcium-dependent phospholipase A2(Pla2g5)

CSB-EP018103RA
Regular price
$677.00 USD
Sale price
$677.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: Pla2g5

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: P51433

AA Sequence: GLLELKSMIEKVTGKNAVKNYGFYGCYCGWGGHGTPKDGTDWCCRMHDRCYGLLEEKHCAIRTQSYDYRFTQDLVICEHDSFCPVRLCACDRKLVYCLRRNLWSYNRLYQYYPNFLC

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-137aa

Protein length: Full Length of Mature Protein

MW: 29.8 kDa

Alternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol.

Reference: Cloning, expression and partial characterization of a novel rat phospholipase A2.Chen J., Engle S.J., Seilhamer J.J., Tischfield J.A.Biochim. Biophys. Acta 1215:115-120(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share