Recombinant Pseudomonas aeruginosa  Preprotein translocase subunit SecE(secE)

Recombinant Pseudomonas aeruginosa Preprotein translocase subunit SecE(secE)

CSB-CF875872EZX
Regular price
$1,093.00 USD
Sale price
$1,093.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:Q9HWC3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNAKAEAKESRFDLLKWLLVAVLVVVAVVGNQYFSAQPILYRVLGILVLAVIAAFLALQT AKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMI VG

Protein Names:Recommended name: Preprotein translocase subunit SecE

Gene Names:Name:secE Ordered Locus Names:PA4276

Expression Region:1-122

Sequence Info:full length protein