Recombinant Ovine astrovirus 1  Non-structural polyprotein 1A(ORF1)

Recombinant Ovine astrovirus 1 Non-structural polyprotein 1A(ORF1)

CSB-CF872822OCAP
Regular price
$1,150.00 USD
Sale price
$1,150.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ovine astrovirus 1 (OAstV-1)

Uniprot NO.:Q9JH67

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KKKGKNKSTKRKRKAVWTEEEYKAMLEKGFTRDQLRIMADAIRDQYYDDEDEQSEEEAGY PDWSDPGDSTDIENEWFGYEQSWKELEPAKSGVVVNTLPKDLVFKYSLDNYPISKQDIQA VAKELKIYEKAISDIISTSVSTDGKWKDDVDAQKILQELDGLWWGINHTLWEHGLMPFTQ RRKRVQQPKNSKGALKTRAPKSAN

Protein Names:Recommended name: Non-structural polyprotein 1A Cleaved into the following 4 chains: 1. Protein p19 2. Transmembrane protein 1A 3. Serine protease p27 Short name= 4. p27 EC= 5. 3.4.21.- 6. Protein p20'

Gene Names:Name:ORF1

Expression Region:641-844

Sequence Info:full length protein

Your list is ready to share