Recombinant Oedogonium cardiacum  Photosystem II reaction center protein L(psbL)

Recombinant Oedogonium cardiacum Photosystem II reaction center protein L(psbL)

CSB-CF464820ODX
Regular price
$1,075.00 USD
Sale price
$1,075.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Oedogonium cardiacum (Filamentous green alga)

Uniprot NO.:B2X1X7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQFDTNKLNEIDINKVSLSEVISRPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFN

Protein Names:Recommended name: Photosystem II reaction center protein L Short name= PSII-L Alternative name(s): PSII 5 kDa protein

Gene Names:Name:psbL

Expression Region:1-60

Sequence Info:full length protein