Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18)
Uniprot NO.:A1KSH5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFIS LVRNYIPNSIRIIVQMAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMGRAEA FAMKEPPLESLIDGIGNGAGYGIMLLVVATVRELIGSGKLLGYTVFQTVQDGGWYQTNGL FLLAPSAFFIIGFLIWGLRTWKPEQAEE
Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D
Gene Names:Name:nqrD Ordered Locus Names:NMC0507
Expression Region:1-208
Sequence Info:full length protein