Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q49410
Gene Names: p37
Organism: Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
AA Sequence: CATKSDNTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYGK
Expression Region: 26-368aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 44.4 kDa
Alternative Name(s):
Relevance: P37 is part of a high-affinity transport system.
Reference: "Insights into Mycoplasma genitalium metabolism revealed by the structure of MG289, an extracytoplasmic thiamine binding lipoprotein." Sippel K.H., Venkatakrishnan B., Boehlein S.K., Sankaran B., Quirit J.G., Govindasamy L., Agbandje-McKenna M., Goodison S., Rosser C.J., McKenna R. Proteins 79:528-536(2011)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.