Recombinant Mouse Aquaporin-4 (Aqp4),partial

Recombinant Mouse Aquaporin-4 (Aqp4),partial

CSB-YP001964MO1
Regular price
$675.00 USD
Sale price
$675.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: Aqp4

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P55088

AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV

Tag info: N-terminal 6xHis-tagged

Expression Region: 253-323aa

Protein length: Partial

MW: 9.9k kDa

Alternative Name(s): Mercurial-insensitive water channel

Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Reference: "Defective secretion of saliva in transgenic mice lacking aquaporin-5 water channels." Ma T., Song Y., Gillespie A., Carlson E.J., Epstein C.J., Verkman A.S. J. Biol. Chem. 274:20071-20074(1999)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share