Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT

CSB-EP322958LDS
Regular price
$792.00 USD
Sale price
$792.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Leiurus quinquestriatus hebraeus (Yellow scorpion)

Delivery time: 3-7 business days

Uniprot ID: P17728

AA Sequence: VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-85aa

Protein length: Full Length

MW: 23.5 kDa

Alternative Name(s): Lqh-alpha-IT Short name: Alpha-IT

Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Reference: "Nucleotide sequence and structure analysis of a cDNA encoding an alpha insect toxin from the scorpion Leiurus quinquestriatus hebraeus." Gurevitz M., Urbach D., Zlotkin E., Zilberberg N.Toxicon 29:1270-1272(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share