Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q5H943
Gene Names: CT83
Organism: Homo sapiens (Human)
AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Expression Region: 1-113aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
MW: 26.8 kDa
Alternative Name(s): Cancer/testis antigen 83
Relevance:
Reference: "CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer." Paret C., Simon P., Vormbrock K., Bender C., Kolsch A., Breitkreuz A., Yildiz O., Omokoko T., Hubich-Rau S., Hartmann C., Hacker S., Wagner M., Roldan D.B., Selmi A., Tureci O., Sahin U. Oncotarget 6:25356-25367(2015)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.