Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: F5HCH8
Gene Names: gL
Organism: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
AA Sequence: AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR
Expression Region: 31-278aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 29.5 kDa
Alternative Name(s):
Relevance: The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL .
Reference: Genetic content of wild-type human cytomegalovirus.Dolan A., Cunningham C., Hector R.D., Hassan-Walker A.F., Lee L., Addison C., Dargan D.J., McGeoch D.J., Gatherer D., Emery V.C., Griffiths P.D., Sinzger C., McSharry B.P., Wilkinson G.W.G., Davison A.J.J. Gen. Virol. 85:1301-1312(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.