Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Cysteine-rich protein 1(CRIP1)

Recombinant Human Cysteine-rich protein 1(CRIP1)

SKU:CSB-EP005969HU

Regular price $753.00 USD
Regular price Sale price $753.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P50238

Gene Names: CRIP1

Organism: Homo sapiens (Human)

AA Sequence: PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Expression Region: 1-77aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 35.4 kDa

Alternative Name(s): Cysteine-rich heart protein

Relevance: Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.

Reference: "Human cysteine-rich intestinal protein: cDNA cloning and expression of recombinant protein and identification in human peripheral blood mononuclear cells." Khoo C., Blanchard R.K., Sullivan V.K., Cousins R.J. Protein Expr. Purif. 9:379-387(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details