Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3)

Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3)

CSB-EP527126HVZ
Regular price
$795.00 USD
Sale price
$795.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: ORF3

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)

Delivery time: 3-7 business days

Uniprot ID: O90299

AA Sequence: MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-114aa

Protein length: Full Length

MW: 27.8 kDa

Alternative Name(s):

Relevance: May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.

Reference: The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II.Ratra R., Kar-Roy A., Lal S.K.Biochemistry 47:1957-1969(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share