Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Uniprot NO.:Q5AXJ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTASSTLGEKLGEAYRARLPRHPFLLFGLPFIMVIVAGSFVLTPATALRYERYDRKVKQL SQEEAMDLGLKGPDGEEGIKRNPRRRIIGDDREEYYRLMAKDLDSWEQKRVQRFKGEPDG RL
Protein Names:Recommended name: Cytochrome c oxidase assembly protein cox16, mitochondrial
Gene Names:Name:cox16 ORF Names:AN10871
Expression Region:13-134
Sequence Info:full length protein