Recombinant Chlorobaculum parvum  ATP synthase subunit a 1(atpB1)

Recombinant Chlorobaculum parvum ATP synthase subunit a 1(atpB1)

CSB-CF459383DSQ
Regular price
$1,176.00 USD
Sale price
$1,176.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))

Uniprot NO.:B3QNH3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLSSDEVVLWQSGFLKLNLTIVTTWAVMLLLAGGSWLITRRLSTGITISRWQSVLEIIV TMARRQIGEVGLQKPEKYLPFIATLFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFI AVPLFGIAESGLVGYLKTYAEPTPIMLPFNIVGELTRTMALAVRLFGNMMSGDMILVILL TISPLVFPVLMNILGLLTGMVQAYIFSILATVYIAAATRTREKSTS

Protein Names:Recommended name: ATP synthase subunit a 1 Alternative name(s): ATP synthase F0 sector subunit a 1 F-ATPase subunit 6 1

Gene Names:Name:atpB1 Ordered Locus Names:Cpar_1068

Expression Region:1-226

Sequence Info:full length protein

Your list is ready to share