Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

CSB-EP316432DSB
Regular price
$795.00 USD
Sale price
$795.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: omcA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Chlamydia trachomatis

Delivery time: 3-7 business days

Uniprot ID: P0CC05

AA Sequence: CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-88aa

Protein length: Full Length

MW: 23.4 kDa

Alternative Name(s): 9 kDa cysteine-rich lipoprotein Short name:9kDa-CRP

Relevance: In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).

Reference: "Cysteine-rich outer membrane proteins of Chlamydia trachomatis display compensatory sequence changes between biovariants."Allen J.E., Cerrone M.C., Beatty P.R., Stephens R.S.Mol. Microbiol. 4:1543-1550(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share