Recombinant Bacillus subtilis subsp. spizizenii  Quinol oxidase subunit 3(qoxC)

Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 3(qoxC)

CSB-CF522190BRM
Regular price
$1,155.00 USD
Sale price
$1,155.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)

Uniprot NO.:E0TW65

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHAEHGNSNAPMEYQSETGRLNILGFWIFLGAEIVLFSTLFATFFVLQNRTAGGVLPDE LFEVNLVMIMTFLLLISSFTCGIAVHEMRRGSLKGVVIWTIITLLLGAGFVGCEINEFVH YVHEGASLGTSAFWSGFFVLLGTHGTHVTIGIFWIIGILIQLKKRGLTPQTSSKIFISSL YWHFLDVVWIFIFTGVYLMGLGGL

Protein Names:Recommended name: Quinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Oxidase aa(3)-600 subunit 3 Quinol oxidase aa3-600, subunit qoxC Quinol oxidase polypeptide III

Gene Names:Name:qoxC Ordered Locus Names:BSUW23_18865

Expression Region:1-204

Sequence Info:full length protein

Your list is ready to share