Recombinant Antifungal protein(afp)

Recombinant Antifungal protein(afp)

CSB-EP325933APN
Regular price
$797.00 USD
Sale price
$797.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: afp

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Aspergillus giganteus

Delivery time: 3-7 business days

Uniprot ID: P17737

AA Sequence: ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC

Tag info: N-terminal 6xHis-B2M-tagged

Expression Region: 44-94aa

Protein length: Full Length

MW: 19.8 kDa

Alternative Name(s):

Relevance: This protein inhibits the growth of a variety of fungal species.

Reference: "NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism."Campos-Olivas R., Bruix M., Santoro J., Lacadena J., Martinez del Pozo A., Gavilanes J.G., Rico M.Biochemistry 34:3009-3021(1995) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share