Gene Bio Systems
Recombinant Zygosaccharomyces rouxii Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
Recombinant Zygosaccharomyces rouxii Cytochrome oxidase assembly protein 3, mitochondrial(COA3)
SKU:CSB-CF512520ZBL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Uniprot NO.:C5E1G5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVLDPSRYQDHRTWKMTPGLIRARQPFFKKNMIGLAILAGVSAGIYTYTYSFLHKDNDFA DVPIPPIDEKELEKLKKEYEQHKQERQ
Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial
Gene Names:Name:COA3 Ordered Locus Names:ZYRO0G20790g
Expression Region:1-87
Sequence Info:full length protein
