Recombinant Zygosaccharomyces rouxii  Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)

Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 34, mitochondrial(AIM34)

CSB-CF512874ZBL
Regular price
$1,171.00 USD
Sale price
$1,171.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)

Uniprot NO.:C5DTC6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LGLSSHAEPWSQMSLKELKVECKNRGLKVSGKKIELVRRLKNLNITNSNDSHLRIDIDRP KPPRNKSKKQVKPINSNVKLDRNIVLNSRINDTITKENDTTPTINESNVKTSPIEHVQNP PVEHMQEPPVDHFGKSSPIKESKDIITTTRPYANGFSTDQDNYQTNSLALRDKIFLLTST TCITIWWWWPHMPSFIDQILKSYKYLQSFL

Protein Names:Recommended name: Altered inheritance of mitochondria protein 34, mitochondrial

Gene Names:Name:AIM34 Ordered Locus Names:ZYRO0C07392g

Expression Region:13-222

Sequence Info:full length protein

Your list is ready to share