Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 11(AIM11)

SKU:CSB-CF511052ZBL

Regular price $1,736.00 USD
Regular price Sale price $1,736.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)

Uniprot NO.:C5DQU6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNVQFSERQISAFSHEYKIRRKRQMLRFFCATALTLVSCRVAYRGMLGRKYIPNMFQLN YKPPPFSYKGEAASALVLGTGLATGGLTMMVFGGCWIADISTFPEFSYKLKRLMGQESDS SQLPMDTETSQIVNQLEQLLNNDKK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 11

Gene Names:Name:AIM11 Ordered Locus Names:ZYRO0B03102g

Expression Region:1-145

Sequence Info:full length protein

View full details