Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zinnia elegans CLAVATA3-ESR (CLE)-related protein TDIF

Recombinant Zinnia elegans CLAVATA3-ESR (CLE)-related protein TDIF

SKU:CSB-CF375515ZBF

Regular price $1,690.00 USD
Regular price Sale price $1,690.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zinnia elegans (Zinnia)

Uniprot NO.:A1EC31

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KLRSTSQISHFTNPRSCSSLFFVALLIITILITMLQSSTSMEVTSLPTHQPTSSNSHDES STSSTATTTTDLHPKRTHHQSHPKPTRSFEAGAHEVPSGPNPISNR

Protein Names:Recommended name: CLAVATA3/ESR (CLE)-related protein TDIF Alternative name(s): Tracheary element differentiation inhibitory factor Cleaved into the following chain: 1. TDIFp

Gene Names:Name:TDIF

Expression Region:27-132

Sequence Info:full length protein

View full details