Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays Oleosin Zm-II(OLE18)

Recombinant Zea mays Oleosin Zm-II(OLE18)

SKU:CSB-CF324230ZAX

Regular price $1,838.00 USD
Regular price Sale price $1,838.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:P21641

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ADRDRSGIYGGAHATYGQQQQQGGGGRPMGEQVKKGMLHDKGPTASQALTVATLFPLGGL LLVLSGLALTASVVGLAVATPVFLIFSPVLVPAALLIGTAVMGFLTSGALGLGGLSSLTC LANTARQAFQRTPDYVEEARRRMAEAAAQAGHKTAQAGQAIQGRAQEAGTGGGAGAGAGG GGRASS

Protein Names:Recommended name: Oleosin Zm-II Alternative name(s): Lipid body-associated protein L2 Oleosin 18 kDa

Gene Names:Name:OLE18 Synonyms:OLE3

Expression Region:2-187

Sequence Info:full length protein

View full details