Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays Chlorophyll a-b binding protein 48, chloroplastic(CAB48)

Recombinant Zea mays Chlorophyll a-b binding protein 48, chloroplastic(CAB48)

SKU:CSB-CF312418ZAX

Regular price $1,842.00 USD
Regular price Sale price $1,842.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:Q00827

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTAAKPKPARSGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEGLSADPETFAK NRELEVIHCRWAIAVGLGCVFPELLARNGVKFGEGVWFKAGSQIFSEGGLSHPGNPSLVH AQSILAIWACQVVLMGAVEGYHVAGGRLGEVVDPLYLGGSFDPLGLGDDPERFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPVNNNAWAYATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 48, chloroplastic Alternative name(s): LHCII type I CAB-48 Short name= LHCP

Gene Names:Name:CAB48

Expression Region:33-264

Sequence Info:full length protein

View full details