Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays Ascorbate-specific transmembrane electron transporter 2

Recombinant Zea mays Ascorbate-specific transmembrane electron transporter 2

SKU:CSB-CF503986ZAX

Regular price $1,911.00 USD
Regular price Sale price $1,911.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:C4IYS8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLGLGVRAAPFTYAAHALAVAAAAMVLVWAIYFRGGLAIEATNKNLIFNVHPVLMLIGY IIIGGEAIMVYRVLPTSNHETNKLIHLVLHGIALVLGAVGIYFAFKNHNESGIANLYSLH SWIGIGTITLYGIQWIVGFVTFFFPGAAPNVKKGVLPWHILFGLFVYILALANAELGFLE KLTFLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYVPIPEN

Protein Names:Recommended name: Ascorbate-specific transmembrane electron transporter 2 EC= 1.-.-.- Alternative name(s): Cytochrome b561-2

Gene Names:

Expression Region:1-236

Sequence Info:full length protein

View full details