Recombinant Zaire ebolavirus Nucleoprotein(NP),partial

SKU: CSB-EP323576ZAB

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: NP

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Delivery time: 3-7 business days

Uniprot ID: P18272

AA Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 488-739aa

Protein length: Partial

MW: 33.1 kDa

Alternative Name(s): Nucleocapsid protein ;Protein N

Relevance: Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as tplate for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.

Reference: Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.Noda T., Watanabe S., Sagara H., Kawaoka Y.J. Virol. 81:3554-3562(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.