Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yop proteins translocation lipoprotein J(yscJ)

Recombinant Yop proteins translocation lipoprotein J(yscJ)

SKU:CSB-CF304884YAS

Regular price $1,877.00 USD
Regular price Sale price $1,877.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:P69972

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CKVDLYTGISQKEGNEMLALLRQEGLSADKEPDKDGKIKLLVEESDVAQAIDILKRKGYP HESFSTLQDVFPKDGLISSPIEELARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNN KGKKGVAASASVFIKHAADIQFDTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSH LPRNTSILSIQVSEESKGHLIGLLSLLILLLPVTNLAQYFWLQRKK

Protein Names:Recommended name: Yop proteins translocation lipoprotein J Alternative name(s): Lipoprotein ylpB Low calcium response locus protein KA

Gene Names:Name:yscJ Synonyms:lcrKA, ylpB Ordered Locus Names:YPCD1.59, y5019, y0022, YP_pCD24

Expression Region:19-244

Sequence Info:full length protein

View full details