Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis UPF0059 membrane protein YPDSF_1370 (YPDSF_1370)

Recombinant Yersinia pestis UPF0059 membrane protein YPDSF_1370 (YPDSF_1370)

SKU:CSB-CF392888YAL

Regular price $1,859.00 USD
Regular price Sale price $1,859.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pestis (strain Pestoides F)

Uniprot NO.:A4TKE7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGMLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA

Protein Names:Recommended name: UPF0059 membrane protein YPDSF_1370

Gene Names:Ordered Locus Names:YPDSF_1370

Expression Region:1-189

Sequence Info:full length protein

View full details