Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis bv. Antiqua UPF0442 protein YPA_4078(YPA_4078)

Recombinant Yersinia pestis bv. Antiqua UPF0442 protein YPA_4078(YPA_4078)

SKU:CSB-CF614084YAF

Regular price $1,745.00 USD
Regular price Sale price $1,745.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis bv. Antiqua (strain Antiqua)

Uniprot NO.:Q1C0I3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMST MVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV

Protein Names:Recommended name: UPF0442 protein YPA_4078

Gene Names:Ordered Locus Names:YPA_4078

Expression Region:1-153

Sequence Info:full length protein

View full details