Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE(yopE)

SKU:CSB-CF330087YQA

Regular price $1,145.00 USD
Regular price Sale price $1,145.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P31492

Gene Names: yopE

Organism: Yersinia enterocolitica

AA Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM

Expression Region: 1-219aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-tagged

MW: 26.9 kDa

Alternative Name(s):

Relevance: Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis

Reference: "Secretion of Yop proteins by Yersiniae."Michiels T., Wattiau P., Brasseur R., Ruysschaert J.M., Cornelis G.Infect. Immun. 58:2840-2849(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details