Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

SKU:CSB-CF721658YAP

Regular price $1,688.00 USD
Regular price Sale price $1,688.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Uniprot NO.:Q6CHT7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSQDPHNGKGTFEVHKQPQPGLKVFRKGKYIDPKTFQMSPALIRARRPFFVRNMLALAGL TGFVAGIYGYTMYSLRTDDFGDVPIPPLDPEEIKKLQSKYSDDSKA

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial

Gene Names:Name:COA3 Ordered Locus Names:YALI0A05137g

Expression Region:1-106

Sequence Info:full length protein

View full details