Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xylella fastidiosa UPF0059 membrane protein XfasM23_1382 (XfasM23_1382)

Recombinant Xylella fastidiosa UPF0059 membrane protein XfasM23_1382 (XfasM23_1382)

SKU:CSB-CF456306XBN

Regular price $1,864.00 USD
Regular price Sale price $1,864.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xylella fastidiosa (strain M23)

Uniprot NO.:B2I611

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPITTLLIGIAMSTDAFAAAIGKGAAIGKPRLRDALYVAVIFGVIETATPIAGWLLGQV ASHYIATFDHWIAFGLLGGLGIHMIVNGLKNNGNTCKDNADTHNRNSRWLTLAATALATS IDAAAIGISMAFLDIHIGIVAAVIGLCTFTMVIFGVMLGRVLGTFVGNRAEIVGGIILII VGSTILYEHLSNTG

Protein Names:Recommended name: UPF0059 membrane protein XfasM23_1382

Gene Names:Ordered Locus Names:XfasM23_1382

Expression Region:1-194

Sequence Info:full length protein

View full details