Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Uncharacterized protein C17orf62 homolog

Recombinant Xenopus tropicalis Uncharacterized protein C17orf62 homolog

SKU:CSB-CF609142XBF

Regular price $1,820.00 USD
Regular price Sale price $1,820.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q0D2D7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYMQVESRTGTLLHLKRNPSIRSWSLLVGISSVGLAAAYYSTDTWLWKLFYVAGCAFVAL QNLEDWEEAIFDKKSGKAILITYSLYKKLLTLCKGGQEQVVVLLKEIRDVNVEEERVRYF GSGYVIVLRFVTGISHPLTQSAVLGARSDVEAVAKELTKFLEFDLVGSRPQAVEESNDSE SDEALDTQ

Protein Names:Recommended name: Uncharacterized protein C17orf62 homolog

Gene Names:

Expression Region:1-188

Sequence Info:full length protein

View full details