Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Trimeric intracellular cation channel type B(tmem38b)

Recombinant Xenopus tropicalis Trimeric intracellular cation channel type B(tmem38b)

SKU:CSB-CF638972XBF

Regular price $1,907.00 USD
Regular price Sale price $1,907.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28FA9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESFSELSLQFSQLSMFPFFETAHYLTSVMSAREQAGAVDVASRSPLASWFSSMLYCFGG GILSSILLAEPPVGILSNTTSIILASAVWYMVYYFPYDLFYNCFFFLPIRLILAGMKEVT RTWKILSGVAHAHSHYKDAMLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGQYLPISRHNLMFIYTLFLILIKVTMMLTRSTASPFLPLETSLQ HILFSRQQIPAEVRESPSSSGDKGKPSKKTLDKDSGEQDNKKDN

Protein Names:Recommended name: Trimeric intracellular cation channel type B Short name= TRIC-B Short name= TRICB Alternative name(s): Transmembrane protein 38B

Gene Names:Name:tmem38b ORF Names:TEgg035c21.1

Expression Region:1-284

Sequence Info:full length protein

View full details