Recombinant Xenopus tropicalis  Transmembrane protein 93(tmem93)

Recombinant Xenopus tropicalis Transmembrane protein 93(tmem93)

CSB-CF023898XBF
Regular price
$1,089.00 USD
Sale price
$1,089.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q6GLC5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGVALKREGPQFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTALYGFIFYFLASF LLSLLLVLKSGRKWNKYFKSRKPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Protein Names:Recommended name: Transmembrane protein 93

Gene Names:Name:tmem93 ORF Names:TEgg053k02.1

Expression Region:1-110

Sequence Info:full length protein