Gene Bio Systems
Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdhd)
Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdhd)
SKU:CSB-CF747401XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q6P355
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LLIRPVPCLTQDHHMVQTSQIHTSPNHHAGSKAASMHWTSERALSVALLGLLPAAYLYPG AAMDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANTSLFALSALTFAGLCYFNYHDVG ICKAVSMLWSL
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cytochrome b small subu
Gene Names:Name:sdhd ORF Names:TNeu097k19.1
Expression Region:22-152
Sequence Info:full length protein
![Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(sdhd)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_aa01159b-c7ef-4cb7-993b-0db4b3d2aac0.jpg?v=1659246134&width=1445)