Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog B

Recombinant Xenopus laevis UPF0444 transmembrane protein C12orf23 homolog B

SKU:CSB-CF725935XBE

Regular price $1,697.00 USD
Regular price Sale price $1,697.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q5U4X2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSETEKIEEAAPPYLCEEPPEGAVKDHPQQQPGMISRVTGGIFSLTRGAVGATIGGVAWI GGKSFEVTKTAVTSVPSIGVGIVKGGVSVVTGSVAAVGSAVSNKVSGKKKDKSD

Protein Names:Recommended name: UPF0444 transmembrane protein C12orf23 homolog B

Gene Names:

Expression Region:1-114

Sequence Info:full length protein

View full details