Recombinant Xenopus laevis Transthyretin(ttr)

Recombinant Xenopus laevis Transthyretin(ttr)

CSB-YP025270XBE
Regular price
$997.00 USD
Sale price
$997.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:B7ZS96

Gene Names:ttr

Organism:Xenopus laevis (African clawed frog)

AA Sequence:APPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL

Expression Region:20-153aa

Sequence Info:Full Length of Mature Protein

Source:Yeast

Tag Info:N-terminal 6xHis-tagged

MW:16.7 kDa

Alternative Name(s):Transthyretin(xTTR)(Prealbumin)

Relevance:Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain.

Reference:"In vitro and in vivo analysis of the thyroid system-disrupting activities of brominated phenolic and phenol compounds in Xenopus laevis." Kudo Y., Yamauchi K., Fukazawa H., Terao Y. Toxicol. Sci. 92:87-95(2006)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:25-35 business days

You may also like

  • Recombinant Human Transthyretin(TTR) (Active)
    Regular price
    $461.00 USD
    Sale price
    $461.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Transthyretin(TTR)
    Regular price
    $602.00 USD
    Sale price
    $602.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Transthyretin(Ttr)
    Regular price
    $770.00 USD
    Sale price
    $770.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Transthyretin(Ttr)
    Regular price
    $874.00 USD
    Sale price
    $874.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share