Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Transmembrane protein 150B-A(tmem150b-a)

Recombinant Xenopus laevis Transmembrane protein 150B-A(tmem150b-a)

SKU:CSB-CF687165XBE

Regular price $1,819.00 USD
Regular price Sale price $1,819.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q4V7T7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IWIVYGMSVSNGSVNLSDGFPYISLCGTDPPQSCVFGQVLNVGAMLGVWISAIRFQQIRD YNCHSVLNSVSLAMGILCALGTSIVGNFQQSNQLETHLAGAFLAFVIGNIYFWMQTALTY MVKPTHGGCYIGPIRFCLSVACTALIVLMAVFLKMNMKSISAICEWIVAMILFLLYGLFA VDFWHLDGHYFHVKKRTVIPNEMQVSTVTLSI

Protein Names:Recommended name: Transmembrane protein 150B-A Alternative name(s): Transmembrane protein 224-A

Gene Names:Name:tmem150b-a Synonyms:tmem224-a

Expression Region:19-230

Sequence Info:full length protein

View full details