![Recombinant Xenopus laevis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhd-b)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_5f065abe-6839-47e5-bf6b-4c1bac67dfe4_{width}x.jpg?v=1659246138)
![Recombinant Xenopus laevis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial(sdhd-b)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_5f065abe-6839-47e5-bf6b-4c1bac67dfe4_530x@2x.jpg?v=1659246138)
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q6AZV0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LLIRPLPCLSQDLHMVQTSQIHTSPNHHAGSKAASMHWTGERALSVALLGLLPAAYLYPG AAMDYSLAAALTLHGHWGLGQVVTDYVHGETKIKMANTSLFALSALTFAGLCYFNYHDVG ICKAVAMLWSL
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial Short name= CybS-B Alternative name(s): Succinate dehydrogenase complex subunit D-B Succinate-ubiquinone oxidoreductase cytochrome b smal
Gene Names:Name:sdhd-b
Expression Region:22-152
Sequence Info:full length protein