Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 3(nkain3)

Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 3(nkain3)

SKU:CSB-CF714906XBE

Regular price $1,779.00 USD
Regular price Sale price $1,779.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q66KZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGCCTGRCTLVFICTLQMLVALERQIFDFLGYQWAPILGNFLHIIVVILGLFGTIQYRPR YIVAYTIWTAFWVAWNVFIICFYLEVGGLSKDTDLMTFNISIHRSWWREHGPGCVWRLVP APPSKNLGDHSFISVTGCIIEYQYLEVIHSAVQILLSLIGFVYACYVISVITDEEDSST

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 3

Gene Names:Name:nkain3

Expression Region:1-179

Sequence Info:full length protein

View full details