Recombinant Xenopus laevis Reprimo-like protein(rprml)

CSB-CF760656XBE

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GM22

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNGTFFNHTLMEQVAYNNTTSQDLGSLMGCCNGSQTVITNDGGSLILIPDERSLFITRVV QIAVLCVLSLTVLFGIFFLGCNLLIKSESMINFLVKDRRPSKDVGAVILGLY

Protein Names:Recommended name: Reprimo-like protein

Gene Names:Name:rprml

Expression Region:1-112

Sequence Info:full length protein