Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q6XQ84
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM
Protein Names:Recommended name: Proximal tubules-expressed gene protein Short name= Xpteg Alternative name(s): MAP17-like protein PDZK1-interacting protein 1-like
Gene Names:Name:pteg
Expression Region:1-122
Sequence Info:full length protein