Recombinant Xenopus laevis  Proximal tubules-expressed gene protein(pteg)

Recombinant Xenopus laevis Proximal tubules-expressed gene protein(pteg)

CSB-CF764988XBE
Regular price
$1,093.00 USD
Sale price
$1,093.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6XQ84

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSLQHVLLILISLGQVYSQQVHHNAGRKFPQWLTGLIAMTVFLFLVLVVYVAKMFWDKR SQESINMKDIEEVVANGTSECCEARKENQYISCNMKDLRSSEHIHAYENPIEVNDNVRST AM

Protein Names:Recommended name: Proximal tubules-expressed gene protein Short name= Xpteg Alternative name(s): MAP17-like protein PDZK1-interacting protein 1-like

Gene Names:Name:pteg

Expression Region:1-122

Sequence Info:full length protein

Your list is ready to share