Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Protein FAM198B(fam198b)

Recombinant Xenopus laevis Protein FAM198B(fam198b)

SKU:CSB-CF003962XBE

Regular price $2,078.00 USD
Regular price Sale price $2,078.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:P86275

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPDRTGRGSSSSSSSLKRLVCKSFVRAWGRRRPNLRRAVLLICTASAIYGIVIASQVLR

Protein Names:Recommended name: Protein FAM198B Alternative name(s): Expressed in nerve and epithelium during development

Gene Names:Name:fam198b Synonyms:ened

Expression Region:1-374

Sequence Info:full length protein

View full details