Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Mitoferrin-2A(slc25a28-a)

Recombinant Xenopus laevis Mitoferrin-2A(slc25a28-a)

SKU:CSB-CF756941XBE

Regular price $1,785.00 USD
Regular price Sale price $1,785.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GLJ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MELEAVLKERTAAAGDPGRVLGAWVRSGWSAAGPSVLESEGGSGGPLAFESTSSRILELA SKDNEPEYEALPDGSNVTTHMLAGAVAGVMEHCLMYPVDCVKTRMQSLQPDPAARYRNVM DALSKIVRTEGFWRPLRGLNVTATGAGPAHALYFACYEKLKKTLSDIIHPGGNSHIANGT DYSCPA

Protein Names:Recommended name: Mitoferrin-2A Alternative name(s): Mitochondrial iron transporter 2-A Solute carrier family 25 member 28-A

Gene Names:Name:slc25a28-a Synonyms:mfrn2-a

Expression Region:1-186

Sequence Info:full length protein

View full details