Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Lysosomal acid phosphatase(acp2)

Recombinant Xenopus laevis Lysosomal acid phosphatase(acp2)

SKU:CSB-CF001177XBE

Regular price $2,108.00 USD
Regular price Sale price $2,108.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:B1H1P9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RELRFVTLVYRHGDRSPVHGYPTDVHKESVWPQGYGQLTQVGMKQHWDLGQELRARYKGFLNESYNRHEIYVRSTDVDRTLMSAEANLAGLYPPEGPQIFNPNITWQPIPIHTIPESEDQLLKFPISPCPAYVKLQEETRQSAEYINMTTTYKAFLQMVANKTGLSDCTLESVWSVYDTLFCEKTHNFSLPTWATADVLSKLNKLKDFSFVFLFGVHERVKKARLQGGVLVDQILKNMTAAANNASNGLKLLAYSAHDSTLGALQLALDVYNGKQAPYASCHIFELYKEDSGNFTVQMYFRNESGKTPYPVSLPGCAHACPLQDFQSLLQPILAQDWEEECQTTSFIMTEETIIGLTIGAIALFIIIVVLMLLSCNEPKDDGYQHVSDEGDDHETKGLAM

Protein Names:Recommended name: Lysosomal acid phosphatase Short name= LAP EC= 3.1.3.2

Gene Names:Name:acp2

Expression Region:33-432

Sequence Info:full length protein

View full details