Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-B(rnf152-b)

Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-B(rnf152-b)

SKU:CSB-CF718080XBE

Regular price $1,809.00 USD
Regular price Sale price $1,809.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q68EV7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRASQKDLRCPWCRGVTKL PPGYSVSELPDDPDVVAVIAIPHASENTPVFIKLPSNGCYMWPLPVSKERALLPGDIGCR LLPGNQQKPVTVVTMPMEQQPLHGNIPQDIIEEEHERRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG

Protein Names:Recommended name: E3 ubiquitin-protein ligase rnf152-B EC= 6.3.2.- Alternative name(s): RING finger protein 152-B

Gene Names:Name:rnf152-b

Expression Region:1-203

Sequence Info:full length protein

View full details